| Reference: | H00026056-Q01 |
| Product name: | RAB11FIP5 (Human) Recombinant Protein (Q01) |
| Product description: | Human RAB11FIP5 partial ORF ( NP_056285.1, 554 a.a. - 652 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 26056 |
| Gene name: | RAB11FIP5 |
| Gene alias: | DKFZp434H018|GAF1|KIAA0857|RIP11|pp75 |
| Gene description: | RAB11 family interacting protein 5 (class I) |
| Genbank accession: | NM_015470 |
| Immunogen sequence/protein sequence: | SGLEKLKTVTSGSIQPVTQAPQAGQMVDTKRLKDSAVLDQSAKYYHLTHDELISLLLQRERELSQRDEHVQELESYIDRLLVRIMETSPTLLQIPPGPP |
| Protein accession: | NP_056285.1 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Shipping condition: | Dry Ice |