No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Proteins |
| Origin species | Human |
| Host species | Wheat Germ (in vitro) |
| Applications | AP,Array,ELISA,WB-Re |
| Reference: | H00022914-P01 |
| Product name: | KLRK1 (Human) Recombinant Protein (P01) |
| Product description: | Human KLRK1 full-length ORF ( NP_031386.1, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 22914 |
| Gene name: | KLRK1 |
| Gene alias: | CD314|D12S2489E|FLJ17759|FLJ75772|KLR|NKG2-D|NKG2D |
| Gene description: | killer cell lectin-like receptor subfamily K, member 1 |
| Genbank accession: | NM_007360.1 |
| Immunogen sequence/protein sequence: | MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIMVAIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV |
| Protein accession: | NP_031386.1 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Shipping condition: | Dry Ice |