Cart 1 Product Products 369,00 € (empty)
No products
To be determined Shipping
369,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 369,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 369,00 €
Data sheet of PADI2 monoclonal antibody (M01), clone 4D4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Monoclonal |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about PADI2 monoclonal antibody (M01), clone 4D4
| Reference: | H00011240-M01 |
| Product name: | PADI2 monoclonal antibody (M01), clone 4D4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PADI2. |
| Clone: | 4D4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 11240 |
| Gene name: | PADI2 |
| Gene alias: | KIAA0994|PAD-H19|PAD2|PDI2 |
| Gene description: | peptidyl arginine deiminase, type II |
| Genbank accession: | NM_007365 |
| Immunogen: | PADI2 (NP_003008, 1 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSEHVWVEVVRDGEAEEVATNGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQ |
| Protein accession: | NP_003008 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |