Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CAPN11 monoclonal antibody (M04), clone 2G2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Monoclonal |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about CAPN11 monoclonal antibody (M04), clone 2G2
| Reference: | H00011131-M04 |
| Product name: | CAPN11 monoclonal antibody (M04), clone 2G2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CAPN11. |
| Clone: | 2G2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 11131 |
| Gene name: | CAPN11 |
| Gene alias: | calpain11 |
| Gene description: | calpain 11 |
| Genbank accession: | NM_007058 |
| Immunogen: | CAPN11 (NP_008989, 557 a.a. ~ 651 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LLNRMAIKFKSFKTKGFGLDACRCMINLMDKDGSGKLGLLEFKILWKKLKKWMDIFRECDQDHSGTLNSYEMRLVIEKAGIKLNNKVMQVLVARY |
| Protein accession: | NP_008989 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |