Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of KLRA1 monoclonal antibody (M01), clone 1H3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Monoclonal |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about KLRA1 monoclonal antibody (M01), clone 1H3
| Reference: | H00010748-M01 |
| Product name: | KLRA1 monoclonal antibody (M01), clone 1H3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant KLRA1. |
| Clone: | 1H3 |
| Isotype: | IgG2b Kappa |
| Gene id: | 10748 |
| Gene name: | KLRA1 |
| Gene alias: | KLRA#|LY49L|Ly-49L|Ly49|MGC126520|MGC126522 |
| Gene description: | killer cell lectin-like receptor subfamily A, member 1 |
| Genbank accession: | NM_006611 |
| Immunogen: | KLRA1 (NP_006602, 66 a.a. ~ 171 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VTNIFQCIQEKHQRQEILRNCSEKYIMQNDNYLKEQILTNKTLKYDVLKNSFQQKKELDSRLIQKNRCHRENEIVFKVLQNTGKFSEDHGSCCGVNCYYFTMQKKD |
| Protein accession: | NP_006602 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |