No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Clonality | Monoclonal |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Reference: | H00010748-M01 |
Product name: | KLRA1 monoclonal antibody (M01), clone 1H3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant KLRA1. |
Clone: | 1H3 |
Isotype: | IgG2b Kappa |
Gene id: | 10748 |
Gene name: | KLRA1 |
Gene alias: | KLRA#|LY49L|Ly-49L|Ly49|MGC126520|MGC126522 |
Gene description: | killer cell lectin-like receptor subfamily A, member 1 |
Genbank accession: | NM_006611 |
Immunogen: | KLRA1 (NP_006602, 66 a.a. ~ 171 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VTNIFQCIQEKHQRQEILRNCSEKYIMQNDNYLKEQILTNKTLKYDVLKNSFQQKKELDSRLIQKNRCHRENEIVFKVLQNTGKFSEDHGSCCGVNCYYFTMQKKD |
Protein accession: | NP_006602 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Shipping condition: | Dry Ice |