Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RAMP2 monoclonal antibody (M05), clone 2F5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Monoclonal |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about RAMP2 monoclonal antibody (M05), clone 2F5
| Reference: | H00010266-M05 |
| Product name: | RAMP2 monoclonal antibody (M05), clone 2F5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RAMP2. |
| Clone: | 2F5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10266 |
| Gene name: | RAMP2 |
| Gene alias: | - |
| Gene description: | receptor (G protein-coupled) activity modifying protein 2 |
| Genbank accession: | NM_005854 |
| Immunogen: | RAMP2 (NP_005845.1, 58 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQPTFSDPPEDV |
| Protein accession: | NP_005845.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |