| Reference: | H00010210-A01 |
| Product name: | TOPORS polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant TOPORS. |
| Gene id: | 10210 |
| Gene name: | TOPORS |
| Gene alias: | LUN|P53BP3|RP31|TP53BPL |
| Gene description: | topoisomerase I binding, arginine/serine-rich |
| Genbank accession: | NM_005802 |
| Immunogen: | TOPORS (NP_005793, 98 a.a. ~ 205 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRERNASVYSPSGPVNRRTTT |
| Protein accession: | NP_005793 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |