Cart 1 Product Products 369,00 € (empty)
No products
To be determined Shipping
369,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 369,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 369,00 €
Data sheet of ZNF263 monoclonal antibody (M01), clone 6G7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Monoclonal |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about ZNF263 monoclonal antibody (M01), clone 6G7
| Reference: | H00010127-M01 |
| Product name: | ZNF263 monoclonal antibody (M01), clone 6G7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ZNF263. |
| Clone: | 6G7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10127 |
| Gene name: | ZNF263 |
| Gene alias: | FPM315|ZKSCAN12 |
| Gene description: | zinc finger protein 263 |
| Genbank accession: | NM_005741 |
| Immunogen: | ZNF263 (NP_005732, 201 a.a. ~ 298 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PEGNMEDKEMTGPQLPESLEDVAMYISQEEWGHQDPSKRALSRDTVQESYENVDSLESHIPSQEVPGTQVGQGGKLWDPSVQSCKEGLSPRGPAPGEE |
| Protein accession: | NP_005732 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |