| Reference: | H00010094-Q01 |
| Product name: | ARPC3 (Human) Recombinant Protein (Q01) |
| Product description: | Human ARPC3 partial ORF ( NP_005710, 79 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 10094 |
| Gene name: | ARPC3 |
| Gene alias: | ARC21|p21-Arc |
| Gene description: | actin related protein 2/3 complex, subunit 3, 21kDa |
| Genbank accession: | NM_005719 |
| Immunogen sequence/protein sequence: | LKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ |
| Protein accession: | NP_005710 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Shipping condition: | Dry Ice |