| Reference:  | H00010015-M01 | 
| Product name:  | PDCD6IP monoclonal antibody (M01), clone 3C4 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant PDCD6IP. | 
| Clone:  | 3C4 | 
| Isotype:  | IgG2a kappa | 
| Gene id:  | 10015 | 
| Gene name:  | PDCD6IP | 
| Gene alias:  | AIP1|Alix|DRIP4|HP95|MGC17003 | 
| Gene description:  | programmed cell death 6 interacting protein | 
| Genbank accession:  | BC020066 | 
| Immunogen:  | PDCD6IP (AAH20066, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVK | 
| Protein accession:  | AAH20066 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Shipping condition:  | Dry Ice |