Cart 1 Product Products 369,00 € (empty)
No products
To be determined Shipping
369,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 369,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 369,00 €
Data sheet of ITGB1BP1 monoclonal antibody (M09), clone 3B2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Monoclonal |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about ITGB1BP1 monoclonal antibody (M09), clone 3B2
| Reference: | H00009270-M09 |
| Product name: | ITGB1BP1 monoclonal antibody (M09), clone 3B2 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant ITGB1BP1. |
| Clone: | 3B2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9270 |
| Gene name: | ITGB1BP1 |
| Gene alias: | DKFZp686K08158|ICAP-1A|ICAP-1B|ICAP-1alpha|ICAP1|ICAP1A|ICAP1B |
| Gene description: | integrin beta 1 binding protein 1 |
| Genbank accession: | BC012264 |
| Immunogen: | ITGB1BP1 (AAH12264, 1 a.a. ~ 200 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNSDTCAEFRIKYVGAIEKLKLSEGKGLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGVGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEKP |
| Protein accession: | AAH12264 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |