Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PDCD5 purified MaxPab mouse polyclonal antibody (B03P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host species | Mouse |
| Applications | WB-Tr |
More info about PDCD5 purified MaxPab mouse polyclonal antibody (B03P)
| Reference: | H00009141-B03P |
| Product name: | PDCD5 purified MaxPab mouse polyclonal antibody (B03P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human PDCD5 protein. |
| Gene id: | 9141 |
| Gene name: | PDCD5 |
| Gene alias: | MGC9294|TFAR19 |
| Gene description: | programmed cell death 5 |
| Genbank accession: | NM_004708.2 |
| Immunogen: | PDCD5 (NP_004699.1, 1 a.a. ~ 125 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY |
| Protein accession: | NP_004699.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Shipping condition: | Dry Ice |