Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CACNA1I monoclonal antibody (M01), clone 2F5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Monoclonal |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about CACNA1I monoclonal antibody (M01), clone 2F5
| Reference: | H00008911-M01 |
| Product name: | CACNA1I monoclonal antibody (M01), clone 2F5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CACNA1I. |
| Clone: | 2F5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 8911 |
| Gene name: | CACNA1I |
| Gene alias: | Cav3.3|KIAA1120 |
| Gene description: | calcium channel, voltage-dependent, T type, alpha 1I subunit |
| Genbank accession: | NM_021096 |
| Immunogen: | CACNA1I (NP_066919, 233 a.a. ~ 331 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GLLRNRCFLEENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKDDVYDFGAGRQDLNASGLCVNWNRYYNVCRTGSA |
| Protein accession: | NP_066919 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |