Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Staphylococcus GlmCat Recombinant Protein
| Brand | ProteoGenix |
| Product type | Proteins |
| Origin species | Staphylococcus |
| Host species | Escherichia coli (E. coli) |
More info about Staphylococcus GlmCat Recombinant Protein
| Brand: | ProteoGenix |
| Proteogenix reference: | PX-P2072-10 |
| Protein delivered with tag?: | Yes |
| Size: | 10 ug |
| Product name: | Staphylococcus GlmCat Recombinant Protein |
| Fragment type: | Partial |
| Origin species: | Staphylococcus |
| Expression system: | Prokaryotic expression |
| Host species: | Escherichia coli (E. coli) |
| Molecular weight with tag if any: | 38.20 kDa |
| Purity estimated: | 0.9 |
| Protein accession: | KEK36855.1 |
| Spec:entrez geneid: | 5330556 |
| Spec:swissprotid: | A6QFR2 |
| Ncbi reference: | KEK36855.1 |
| Aliases / synonyms: | GlmCat, Bifunctional autolysin |
| Protein sequence (w/o tag): | MAHNHRHKHKLVNAKDLTAPTAVKPTTSAAKDYNYTYVIKNGNGYYYVTPNSDTAKYSLKAFNEQPFAVVKEQVINGQTWYYGKLSNGKLAWIKSTDLAKELIKYNQTGMTLNQVAQIQAGLQYKPQVQRVPGKWTGANFNDVKHAMDTKRLAQDPALKYQFLRLDQPQNISIDKINQFLKGKGVLENQGAAFNKAAQMYGINEVYLISHALLETGNGTSQLAKGADVVNNKVVTNSNTKYHNVFGIAAYDNDPL |
| Form: | Frozen |
| Buffer: | PBS, pH 7.5 |
| Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Delivery condition: | Dry Ice |
| Delivery lead time in business days: | 10-25 |
| Related products: | - Staphylococcus GlmR3 Recombinant Protein - Human Human DCLK3 partial (162-632) Recombinant Protein - synthetic construction IA-2 Recombinant Protein |