New product
Availability date:
| Brand | ProteoGenix |
| Product type | Proteins |
| Origin species | Human |
| Host species | Escherichia coli (E. coli) |
| Brand: | ProteoGenix |
| Proteogenix reference: | PX-P2053-10 |
| Protein delivered with tag?: | Yes |
| Size: | 10 ug |
| Product name: | Human UHRF1(400-660) tagged Recombinant Protein |
| Fragment type: | Partial |
| Origin species: | Human |
| Expression system: | Prokaryotic expression |
| Host species: | Escherichia coli (E. coli) |
| Molecular weight with tag if any: | 30,19 kDa |
| Purity estimated: | 0.9 |
| Protein accession: | AAF28469.1 |
| Spec:entrez geneid: | 29128 |
| Spec:ncbi gene aliases: | hUHRF1, ICBP90, RNF106, Np95, huNp95, hNP95 |
| Spec:swissprotid: | Q96T88 |
| Ncbi reference: | AAF28469.1 |
| Uniprot id: | Q96T88 |
| Uniprot link: | http://www.uniprot.org/uniprot/Q96T88 |
| Aliases / synonyms: | ICBP[400-660], transcription factor ICBP90 |
| Protein sequence (w/o tag): | MAHNHRHKHKLMACVGRTKECTIVPSNHYGPIPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDD VDHGNFFTYTGSGGRDLSGNKRTAEQSCDQKLTNTNRALALNCFAPINDQEGAEAKDWRSGKPVRVVRNVKGGKNSKYAP AEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDDEPGPWTKEGKDRIKKLGLTMQYPEGYLEALANREREKENSKREE EEQQEGGFASPRTGKGKWKRKSAGGGPSRAG |
| Form: | liquid |
| Buffer: | 100mM Na2HPO4, TrisHCl 10mM, Urea 8M in denaturing conditions. PBS if renaturation. |
| Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Delivery condition: | Dry Ice |
| Delivery lead time in business days: | 10-25 |
| Related products: | - Cow SAA3 Recombinant Protein - Human CD123 Recombinant Protein - Human PSMA/FOLH1 Recombinant Protein |