New product
Availability date:
| Brand | ProteoGenix |
| Product type | Proteins |
| Origin species | Toxoplasma gondii |
| Host species | Escherichia coli (E. coli) |
| Brand: | ProteoGenix |
| Proteogenix reference: | PX-P1102-10 |
| Protein delivered with tag?: | Yes |
| Size: | 10 ug |
| Product name: | Toxoplasma gondii GRA6Nt(41-152)(RH) Recombinant Protein |
| Fragment type: | Partial |
| Origin species: | Toxoplasma gondii |
| Expression system: | Prokaryotic expression |
| Host species: | Escherichia coli (E. coli) |
| Molecular weight with tag if any: | 17,46 kDa |
| Purity estimated: | 0.9 |
| Protein accession: | AAC37235.1 |
| Spec:swissprotid: | Q27003 |
| Ncbi reference: | AAC37235.1 |
| Uniprot id: | Q27003 |
| Uniprot link: | http://www.uniprot.org/uniprot/Q27003 |
| Aliases / synonyms: | GRA6Nt(41-152)(RH), dense granule antigen |
| Protein sequence (w/o tag): | MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTRVAADSGGVKQTPSETGSSGGQQEAAGTTEDYVNSSAMGGGQ GDSLAEDDTTSDAAEGDVDPFPVLANEGKSEARGPSLEERIEEQGTRRRYSSVQEPQAKVPSKRTQKRHRKLAAALEHHH HHH |
| Form: | liquid |
| Buffer: | PBS, imidazole 300mM in native conditions. NaH2PO4 100mM, TrisBase 10mM, Urea 8M, imidazole 400mM in denaturig conditions |
| Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Delivery condition: | Dry Ice |
| Delivery lead time in business days: | 10-25 |
| Related products: | - Schistosoma GST Recombinant Protein - Trichinella spiralis GST24 Recombinant Protein - Human GSTP1 Recombinant Protein |