No products
Prices are tax excluded
New product
Availability date:
| Brand | Cloud Clone |
| Product type | Primary antibodies |
| Reactivity | Mouse |
| Clonality | Polyclonal |
| Host species | Rabbit |
| Applications | WB, ICC, IHC-P, IHC-F, ELISA |
| Catalog no.: | PAB257Mu01 |
| Product name: | Polyclonal Antibody to Scavenger Receptor Class D Member 1 (SCARD1) |
| Immunogen: | SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA) |
| Concentration: | 200ug/ml |
| Alternative names: | CD68, GP110, Macrosialin, Macrophage Antigen CD68 |
| Applicable secondary antibody: | SAA544Rb59, SAA544Rb58, SAA544Rb57, SAA544Rb18, SAA544Rb19 |
| Delivery condition: | 4â with ice bags |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 4â for frequent use. Aliquot and store at -20â for 12 months. |