New product
Availability date:
| Brand | Cloud Clone |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Monoclonal |
| Host species | Mouse |
| Applications | WB, ICC, IHC-P, IHC-F, ELISA |
| Catalog no.: | MAA537Hu22 |
| Product name: | Monoclonal Antibody to Enolase, Neuron Specific (NSE) |
| Concentration: | 500ug/ml |
| Immunogen: | Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT |
| Alternative names: | ENO2; Enolase 2; Gamma Enolase; 2-phospho-D-glycerate hydro-lyase; Neural enolase |
| Applicable secondary antibody: | SAA544Mu08, SAA544Mu09, SAA544Mu07, SAA544Mu19, SAA544Mu18, SAA544Mu17 |
| Delivery condition: | 4â with ice bags |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 4 â for frequent use. Aliquot and store at -20 â for 12 months. |