New product
Availability date:
| Brand | Cloud Clone |
| Product type | Proteins |
| Origin species | Mouse |
| Host species | Escherichia coli (E. coli) |
| Applications | SDS-PAGE, WB, ELISA, IP |
| Catalog no.: | RPC117Mu01 |
| Product name : | Recombinant Activin A Receptor Type II A (ACVR2A) |
| Uniprot id: | P27038 |
| Purity: | ⥠92% |
| Predicted molecular mass(kd): | 18.3kDa |
| Fragment: | Ala20~Lys95+TALKCTFVAVRAICVMKSPLIFRRWKSHSPLQILLHRSHPDSSTTTTTTEIRLLTKPERKLSWLLPPLSNN |
| Tag: | N-terminal His-Tag |
| Expression system: | Prokaryotic expression |
| Delivery condition: | 4â with ice bags |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 4â for frequent use. Aliquot and store at -20â for 12 months. |