No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Clonality | Monoclonal |
Host species | Mouse |
Applications | WB-Ce,IHC-P,IF,Flow Cyt |
Product description: | Mouse monoclonal antibody raised against partial recombinant human Villin. |
Clone: | VIL1/1325 |
Isotype: | IgG1, kappa |
Immunogen: | Recombinant protein corresponding to 133 residues of human Villin. |
Immunogen sequence/protein sequence: | MGPESTRMERLRGMTLAKEIRDQERGGRTYVGVVDGENELASPKLMEVMNHVLGKRRELKAAVPDTVVEPALKAALKLYHVSDSEGNLVVREVATRPLTQDLLSHEDCYILDQGGLKIYVWKGKKANEQEKKGA |
Form: | Liquid |
Recommend dilutions: | Flow Cytometry (0.5-1 ug/106 cells in 0.1 mL) Immunofluorescence (1-2 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (0.25-0.5 ug/mL) Western Blotting (1-2 ug/mL) The optimal working dilution should be d |
Storage buffer: | In 10 mM PBS. |
Storage instruction: | Store at -20 to -80°C. Aliquot to avoid repeated freezing and thawing. |
Size: | 100 ug |
Shipping condition: | Dry Ice |