| Brand | Abnova | 
| Product type | Primary antibodies | 
| Reactivity | Human | 
| Clonality | Monoclonal | 
| Host species | Mouse | 
| Applications | WB-Ce,IHC-P,IF,Flow Cyt | 
| Product description: | Mouse monoclonal antibody raised against partial recombinant human Villin. | 
| Clone: | VIL1/1325 | 
| Isotype: | IgG1, kappa | 
| Immunogen: | Recombinant protein corresponding to 133 residues of human Villin. | 
| Immunogen sequence/protein sequence: | MGPESTRMERLRGMTLAKEIRDQERGGRTYVGVVDGENELASPKLMEVMNHVLGKRRELKAAVPDTVVEPALKAALKLYHVSDSEGNLVVREVATRPLTQDLLSHEDCYILDQGGLKIYVWKGKKANEQEKKGA | 
| Form: | Liquid | 
| Recommend dilutions: | Flow Cytometry (0.5-1 ug/106 cells in 0.1 mL) Immunofluorescence (1-2 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (0.25-0.5 ug/mL) Western Blotting (1-2 ug/mL) The optimal working dilution should be d  | 
| Storage buffer: | In 10 mM PBS (0.05% BSA, 0.05% sodium azide). | 
| Storage instruction: | Store at 4°C. | 
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. | 
| Size: | 100 ug | 
| Shipping condition: | Blue Ice |