| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Monoclonal |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,Flow Cyt |
| Product description: | Mouse monoclonal antibody raised against partial recombinant human Villin. |
| Clone: | VIL1/1325 |
| Isotype: | IgG1, kappa |
| Immunogen: | Recombinant protein corresponding to 133 residues of human Villin. |
| Immunogen sequence/protein sequence: | MGPESTRMERLRGMTLAKEIRDQERGGRTYVGVVDGENELASPKLMEVMNHVLGKRRELKAAVPDTVVEPALKAALKLYHVSDSEGNLVVREVATRPLTQDLLSHEDCYILDQGGLKIYVWKGKKANEQEKKGA |
| Form: | Liquid |
| Recommend dilutions: | Flow Cytometry (0.5-1 ug/106 cells in 0.1 mL) Immunofluorescence (1-2 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (0.25-0.5 ug/mL) Western Blotting (1-2 ug/mL) The optimal working dilution should be d |
| Storage buffer: | In 10 mM PBS (0.05% BSA, 0.05% sodium azide). |
| Storage instruction: | Store at 4°C. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Size: | 100 ug |
| Shipping condition: | Blue Ice |