Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MAP3K1 monoclonal antibody, clone 2F6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Monoclonal |
| Host species | Mouse |
| Applications | WB,IHC-P,IF,Flow Cyt |
More info about MAP3K1 monoclonal antibody, clone 2F6
| Product description: | Mouse monoclonal antibody raised against partial recombinant human MAP3K1. |
| Clone: | 2F6 |
| Isotype: | IgG2a, kappa |
| Gene id: | 4214 |
| Gene name: | MAP3K1 |
| Gene alias: | MAPKKK1|MEKK|MEKK1 |
| Gene description: | mitogen-activated protein kinase kinase kinase 1 |
| Immunogen: | Recombinant protein corresponding to amino acids 1077-1176 of human MAP3K1. |
| Immunogen sequence/protein sequence: | SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTPVEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK |
| Protein accession: | Q13233 |
| Form: | Liquid |
| Recommend dilutions: | Flow Cytometry (0.5-1 ug/106 cells in 0.1 mL) Immunofluorescence (1-2 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (0.5-1 ug/mL) Western Blot (0.5-1 ug/mL) The optimal working dilution should be determ |
| Storage buffer: | In 10 mM PBS (0.05% BSA, 0.05% sodium azide). |
| Storage instruction: | Store at 4°C. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Size: | 100 ug |
| Shipping condition: | Blue Ice |