Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Clonality | Monoclonal |
Host species | Mouse |
Applications | WB,IHC-P,IF,Flow Cyt |
Product description: | Mouse monoclonal antibody raised against partial recombinant human MAP3K1. |
Clone: | 2F6 |
Isotype: | IgG2a, kappa |
Gene id: | 4214 |
Gene name: | MAP3K1 |
Gene alias: | MAPKKK1|MEKK|MEKK1 |
Gene description: | mitogen-activated protein kinase kinase kinase 1 |
Immunogen: | Recombinant protein corresponding to amino acids 1077-1176 of human MAP3K1. |
Immunogen sequence/protein sequence: | SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTPVEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK |
Protein accession: | Q13233 |
Form: | Liquid |
Recommend dilutions: | Flow Cytometry (0.5-1 ug/106 cells in 0.1 mL) Immunofluorescence (1-2 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (0.5-1 ug/mL) Western Blot (0.5-1 ug/mL) The optimal working dilution should be determ |
Storage buffer: | In 10 mM PBS (0.05% BSA, 0.05% sodium azide). |
Storage instruction: | Store at 4°C. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Size: | 100 ug |
Shipping condition: | Blue Ice |