| Product description: | Mouse monoclonal antibody raised against a partial recombinant FAS. |
| Clone: | 7G10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 355 |
| Gene name: | FAS |
| Gene alias: | ALPS1A|APO-1|APT1|CD95|FAS1|FASTM|TNFRSF6 |
| Gene description: | Fas (TNF receptor superfamily, member 6) |
| Genbank accession: | BC012479.1 |
| Immunogen: | FAS (AAH12479.1, 211 a.a. ~ 320 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | ESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITS |
| Protein accession: | AAH12479.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Size: | 100 ug |
| Shipping condition: | Dry Ice |