| Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFRSF10C. |
| Clone: | 3A1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 8794 |
| Gene name: | TNFRSF10C |
| Gene alias: | CD263|DCR1|LIT|MGC149501|MGC149502|TRAILR3|TRID |
| Gene description: | tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain |
| Genbank accession: | NM_003841.2 |
| Immunogen: | TNFRSF10C (NP_003832.2, 25 a.a. ~ 161 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | SATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVET |
| Protein accession: | NP_003832.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Size: | 100 ug |
| Shipping condition: | Dry Ice |