Cart 17 Product Products 5 032,08 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x STAT3...259,07 € -
No products
To be determined Shipping
5 032,08 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 17 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 5 032,08 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 5 032,08 €
Data sheet of GST tag monoclonal antibody, clone S2
| Brand | Abnova |
| Product type | Primary antibodies |
| Host species | Mouse |
| Applications | S-ELISA,WB-Re |
More info about GST tag monoclonal antibody, clone S2
| Brand: | Abnova |
| Reference: | MAB0042-M02 |
| Product name: | GST tag monoclonal antibody, clone S2 |
| Product description: | Mouse monoclonal antibody raised against GST recombinant protein. |
| Isotype: | IgG1 |
| Genbank accession: | U78874 |
| Immunogen: | GST tag. MW of the GST tag is 26 KDa. |
| Immunogen sequence/protein sequence: | MESPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLEDPGYRGRTSFV |
| Protein accession: | AAB37352 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against GST on ELISA and Western Blot. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (25.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged is 0.03 ng/ml as a capture antibody. |
| Applications: | S-ELISA,WB-Re |
| Shipping condition: | Dry Ice |