| Brand: | Abnova |
| Reference: | H00729991-M03 |
| Product name: | MEF2BNB monoclonal antibody (M03), clone 1B5 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant MEF2BNB. |
| Clone: | 1B5 |
| Isotype: | IgG2b Kappa |
| Gene id: | 729991 |
| Gene name: | MEF2BNB |
| Gene alias: | - |
| Gene description: | MEF2B neighbor |
| Genbank accession: | BC004449.1 |
| Immunogen: | MEF2BNB (AAH04449.1, 1 a.a. ~ 109 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQSQGAIYTVEYACSAVKNLVDSSVHFRSVEGLLKQAISIRDHMNASAQGHR |
| Protein accession: | AAH04449.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to MEF2BNB on HeLa cell . [antibody concentration 10 ug/ml] |
| Applications: | IF,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |