Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MUC5B polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about MUC5B polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00727897-A01 |
| Product name: | MUC5B polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant MUC5B. |
| Gene id: | 727897 |
| Gene name: | MUC5B |
| Gene alias: | MG1|MUC5|MUC9 |
| Gene description: | mucin 5B, oligomeric mucus/gel-forming |
| Genbank accession: | XM_039877 |
| Immunogen: | MUC5B (XP_039877.9, 4186 a.a. ~ 4295 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | CEEDSCQVRINTTILWHQGCETEVNITFCEGSCPGASKYSAEAQAMQHQCTCCQERRVHEETVPLHCPNGSAILHTYTHVDECGCTPFCVPAPMAPPHTRGFPAQEATAV |
| Protein accession: | XP_039877.9 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Multimolecular Salivary Mucin Complex Is Altered in Saliva of Cigarette Smokers: Detection of Disulfide Bridges by Raman Spectroscopy.Taniguchi M, Iizuka J, Murata Y, Ito Y, Iwamiya M, Mori H, Hirata Y, Mukai Y, Mikuni-Takagaki Y. BioMed Research International Volume 2013 (2013), Article ID 168765, 7 pages |