No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00653509-M06 |
| Product name: | SFTPA1 monoclonal antibody (M06), clone 4C4 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant SFTPA1. |
| Clone: | 4C4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 653509 |
| Gene name: | SFTPA1 |
| Gene alias: | COLEC4|FLJ51913|SFTP1|SP-A|SP-A1 |
| Gene description: | surfactant protein A1 |
| Genbank accession: | NM_001164646.1 |
| Immunogen: | SFTPA1 (NP_001158118.1, 83 a.a. ~ 199 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF |
| Protein accession: | NP_001158118.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.61 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunofluorescence of monoclonal antibody to SFTPA1 on HeLa cell . [antibody concentration 10 ug/ml] |
| Applications: | IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |