No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00653509-M03 |
Product name: | SFTPA1 monoclonal antibody (M03), clone 1G8 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant SFTPA1. |
Clone: | 1G8 |
Isotype: | IgG1 Kappa |
Gene id: | 653509 |
Gene name: | SFTPA1 |
Gene alias: | COLEC4|FLJ51913|SFTP1|SP-A|SP-A1 |
Gene description: | surfactant protein A1 |
Genbank accession: | NM_001164646.1 |
Immunogen: | SFTPA1 (NP_001158118.1, 83 a.a. ~ 199 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF |
Protein accession: | NP_001158118.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (38.61 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged SFTPA1 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |