| Brand: | Abnova |
| Reference: | H00619208-P02 |
| Product name: | C6orf225 (Human) Recombinant Protein (P02) |
| Product description: | Human C6orf225 full-length ORF (NP_001028736.1, 1 a.a. - 80 a.a.) recombinant protein with GST tag at N-terminal. |
| Gene id: | 619208 |
| Gene name: | C6orf225 |
| Gene alias: | DKFZp586F0922 |
| Gene description: | chromosome 6 open reading frame 225 |
| Genbank accession: | NM_001033564.1 |
| Immunogen sequence/protein sequence: | MPFQFGTQPRRFPVEGGDSSIELEPGLSSSAACNGKEMSPTRQLRRCPGSHCLTITDVPVTVYATTRKPPAQSSKEMHPK |
| Protein accession: | NP_001028736.1 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |