| Brand: | Abnova |
| Reference: | H00553115-B01P |
| Product name: | PEF1 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human PEF1 protein. |
| Gene id: | 553115 |
| Gene name: | PEF1 |
| Gene alias: | PEF1A|PEFLIN |
| Gene description: | penta-EF-hand domain containing 1 |
| Genbank accession: | BC002773 |
| Immunogen: | PEF1 (AAH02773, 1 a.a. ~ 284 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MASYPYRQGCPGAAGQAPGAPPGSYYPGPPNSGGQYGSGLPPGGGYGGPAPGGPYGPPAGGGPYGHPNPGMFPSGTPGGPYGGAAPGGPYGQPPPSSYGAQQPGLYGQGGAPPNVDPEAYSWFQSVDSDHSGYISMKELKQALVNCNWSSFNDETCLMMINMFDKTKSGRIDVYGFSALWKFIQQWKNLFQQYDRDRSGSISYTELQQALSQMGYNLSPQFTQLLVSRYCPRSANPAMQLDRFIQVCTQLQVLTEAFREKDTAVQGNIRLSFEDFVTMTASRML |
| Protein accession: | AAH02773 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PEF1 MaxPab polyclonal antibody. Western Blot analysis of PEF1 expression in human thyroid (diffuse hyperplasia). |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |