Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00441519-B01P |
Product name: | CT45A3 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human CT45A3 protein. |
Gene id: | 441519 |
Gene name: | CT45A3 |
Gene alias: | CT45-3|CT45.3 |
Gene description: | cancer/testis antigen family 45, member A3 |
Genbank accession: | NM_001017435.1 |
Immunogen: | CT45A3 (NP_001017435.1, 1 a.a. ~ 189 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMTGHAIPPSQLDSQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADIKRKLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI |
Protein accession: | NP_001017435.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CT45A3 expression in transfected 293T cell line (H00441519-T01) by CT45A3 MaxPab polyclonal antibody. Lane 1: CT45A3 transfected lysate(20.79 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |