No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00440068-M01A |
| Product name: | CARD17 monoclonal antibody (M01A), clone 1G6 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant CARD17. |
| Clone: | 1G6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 440068 |
| Gene name: | CARD17 |
| Gene alias: | INCA |
| Gene description: | caspase recruitment domain family, member 17 |
| Genbank accession: | NM_001007232.1 |
| Immunogen: | CARD17 (NP_001007233.1, 1 a.a. ~ 110 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MADKVLKEKRKQFIRSVGEGTINGLLGELLETRVLSQEEIEIVKCENATVMDKARALLDSVIRKGAPACQICITYICEEDSHLAGTLGLSAGPTSGNHLTTQDSQIVLPS |
| Protein accession: | NP_001007233.1 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.3 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of CARD17 expression in transfected 293T cell line by CARD17 monoclonal antibody (M01A), clone 1G6. Lane 1: CARD17 transfected lysate(11.9 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |