Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MGC27121 MaxPab mouse polyclonal antibody (B01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host species | Mouse |
| Applications | WB-Tr |
More info about MGC27121 MaxPab mouse polyclonal antibody (B01)
| Product description: | Mouse polyclonal antibody raised against a full-length human MGC27121 protein. |
| Gene id: | 408263 |
| Gene name: | C5orf40 |
| Gene alias: | MGC27121 |
| Gene description: | chromosome 5 open reading frame 40 |
| Genbank accession: | NM_001001343 |
| Immunogen: | MGC27121 (NP_001001343, 1 a.a. ~ 224 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MNIEVGNISYTGAIISWSSSEPCLEDYYHIMYRPNWNSIFSGYLRYSFHNEEKVPRTISSVVLEHLAPSTLYFLCISCKKAAFPYRHYCTMFHTLDKSPLAPGSSLVDPQISLWVLMAILLACFTAVLAFICLQFWCVRCHEPRWSYRAGHMEEANGLVRWPEEAPDLGQREEDLQGLPLVEMPRKNSRDGAELDPEANQDAPDAGALQRGGGDPPAILPHCGE |
| Protein accession: | NP_001001343 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Size: | 50 uL |
| Shipping condition: | Dry Ice |