| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,WB-Tr |
| Brand: | Abnova |
| Reference: | H00401546-B01 |
| Product name: | C9orf152 MaxPab mouse polyclonal antibody (B01) |
| Product description: | Mouse polyclonal antibody raised against a full-length human C9orf152 protein. |
| Gene id: | 401546 |
| Gene name: | C9orf152 |
| Gene alias: | MGC131682|bA470J20.2 |
| Gene description: | chromosome 9 open reading frame 152 |
| Genbank accession: | NM_001012993.1 |
| Immunogen: | C9orf152 (NP_001013011.1, 1 a.a. ~ 218 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAEGSRTQAPGKGPPLSIQFLRAQYEGLKRQQRTQAHLLVLPKGGNTPAPAESMVNAVWINKERRSSLSLEEADSEVEGRLEEAAQGCLQAPKSPWHTHLEMHCLVQTSPQDTSHQVHHRGKLVGSDQRLPPEGDTHLFETNQMTQQGTGIPEAAQLPCQVGNTQTKAVESGLKFSTQCPLSIKNPHRSGKPAYYPFPQRKTPRISQAARNLGLYGSA |
| Protein accession: | NP_001013011.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of C9orf152 expression in transfected 293T cell line (H00401546-T01) by C9orf152 MaxPab polyclonal antibody. Lane 1: C9orf152 transfected lysate(23.98 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |