Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse |
Host species | Rabbit |
Applications | WB-Ti,WB-Tr |
Brand: | Abnova |
Reference: | H00401541-D01P |
Product name: | CENPP purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human CENPP protein. |
Gene id: | 401541 |
Gene name: | CENPP |
Gene alias: | CENP-P|FLJ33928 |
Gene description: | centromere protein P |
Genbank accession: | NM_001012267.1 |
Immunogen: | CENPP (NP_001012267.1, 1 a.a. ~ 288 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MDAELAEVRALQAEIAALRRACEDPPAPWEEKSRVQKSFQAIHQFNLEGWKSSKDLKNQLGHLESELSFLSTLTGINIRNHSKQTEDLTSTEMTEKSIRKVLQRHRLSGNCHMVTFQLEFQILEIQNKERLSSAVTDLNIIMEPTECSELSEFVSRAEERKDLFMFFRSLHFFVEWFEYRKRTFKHLKEKYPDAVYLSEGPSSCSMGIRSASRPGFELVIVWRIQIDEDGKVFPKLDLLTKVPQRALELDKNRAIETAPLSFRTLVGLLGIEAALESLIKSLCAEENN |
Protein accession: | NP_001012267.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![]() |
Application image note: | Western Blot analysis of CENPP expression in transfected 293T cell line (H00401541-T01) by CENPP MaxPab polyclonal antibody. Lane 1: CENPP transfected lysate(33.20 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |