| Brand: | Abnova |
| Reference: | H00388677-M01 |
| Product name: | NOTCH2NL monoclonal antibody (M01), clone 2G12-2A5 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant NOTCH2NL. |
| Clone: | 2G12-2A5 |
| Isotype: | IgG1 kappa |
| Gene id: | 388677 |
| Gene name: | NOTCH2NL |
| Gene alias: | N2N |
| Gene description: | Notch homolog 2 (Drosophila) N-terminal like |
| Genbank accession: | BC019835 |
| Immunogen: | NOTCH2NL (AAH19835, 1 a.a. ~ 236 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGICLNLPGSYQCQCLQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLPETVRRGTELWERDREVWNGKEHDEN |
| Protein accession: | AAH19835 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (51.7 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to NOTCH2NL on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |