| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00376267-M01 |
| Product name: | RAB15 monoclonal antibody (M01), clone 1G12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RAB15. |
| Clone: | 1G12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 376267 |
| Gene name: | RAB15 |
| Gene alias: | - |
| Gene description: | RAB15, member RAS onocogene family |
| Genbank accession: | BC040679 |
| Immunogen: | RAB15 (AAH40679, 99 a.a. ~ 208 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | IMKWVSDVDEVGDATSLPGCGEGASPGKARRGPDGKANASRKLCLPQPWMKTSGTHQKASRRSLLGIRLMRSRNGRWEESKGSSWRRSMAWTSMKQVPAPTSTLKSHSRV |
| Protein accession: | AAH40679 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of RAB15 expression in transfected 293T cell line by RAB15 monoclonal antibody (M01), clone 1G12. Lane 1: RAB15 transfected lysate(23.5 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |