MAST4 polyclonal antibody (A01) View larger

MAST4 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAST4 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about MAST4 polyclonal antibody (A01)

Brand: Abnova
Reference: H00375449-A01
Product name: MAST4 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant MAST4.
Gene id: 375449
Gene name: MAST4
Gene alias: DKFZp686E18148|DKFZp686N1467|FLJ16540|FLJ33039|KIAA0303
Gene description: microtubule associated serine/threonine kinase family member 4
Genbank accession: XM_291141
Immunogen: MAST4 (XP_291141, 2605 a.a. ~ 2699 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: LPLESHHPDPNTMGGASHRDRALSVTATVGETKGKDPAPAQPPPARKQNVGRDVTKPSPAPNTDRPISLSNEKDFVVRQRRGKESLRSSPHKKAL
Protein accession: XP_291141
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00375449-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.56 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MAST4 polyclonal antibody (A01) now

Add to cart