No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00375307-M01 |
Product name: | MGC50811 monoclonal antibody (M01), clone 2C3 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant MGC50811. |
Clone: | 2C3 |
Isotype: | IgG1 Kappa |
Gene id: | 375307 |
Gene name: | C2orf62 |
Gene alias: | MGC50811 |
Gene description: | chromosome 2 open reading frame 62 |
Genbank accession: | BC052750 |
Immunogen: | MGC50811 (AAH52750, 1 a.a. ~ 387 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSSKVYSTGSRAKDHQPSGPECLPLPEANAEAIDFLSSLHKEELQMLFFSETLAMVSDTGEPQGELTIEVQRGKYQEKLGMLTYCLFVHASSRGFLDKMLCGNSLLGYLSEKLELMEQHSQDFIKFLILPMERKMSLLKQDDQLAVTRSIKEGEEVKTGVTSFPWSSIKGFISEAANLVLLRVMAWRRMVPSNARFLTLDTEGKLCYLTYQNLGFQTIQVDHQQAEVFIVEQTVHAEEGIPMSCQYYLLSDGHLAKRIQVGSPGCCIITKMPILREEDEIEPRPVFEKKPLVWEEDMELYSKFLDRKEELRLGHASYLRQHPEAHALISDFLLFLLLRQPEDVVTFAAEFFGPFDPWRPSSPALGSSHRPNPFRSLEPEGDARSGAA |
Protein accession: | AAH52750 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (68.31 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged C2orf62 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |