No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ti,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00374395-M01 |
Product name: | TMEM179B monoclonal antibody (M01), clone 3G8 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant TMEM179B. |
Clone: | 3G8 |
Isotype: | IgG2a Kappa |
Gene id: | 374395 |
Gene name: | TMEM179B |
Gene alias: | - |
Gene description: | transmembrane protein 179B |
Genbank accession: | NM_199337.1 |
Immunogen: | TMEM179B (NP_955369.1, 1 a.a. ~ 219 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MALSWLQRVELALFAAAFLCGAVAAAAMTRTQGSFSGRCPLYGVATLNGSSLALSRPSAPSLCYFVAGASGLLALYCLLLLLFWIYSSCIEDSHRGAIGLRIALAISAIAVFLVLVSACILRFGTRSLCNSIISLNTTISCSEAQKIPWTPPGTALQFYSNLHNAETSSWVNLVLWCVVLVLQVVQWKSEATPYRPLERGDPEWSSETDALVGSRLSHS |
Protein accession: | NP_955369.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (50 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | TMEM179B monoclonal antibody (M01), clone 3G8. Western Blot analysis of TMEM179B expression in human lung cancer. |
Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |