No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
| Brand: | Abnova |
| Reference: | H00374378-M01 |
| Product name: | GALNTL4 monoclonal antibody (M01), clone 1F9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GALNTL4. |
| Clone: | 1F9 |
| Isotype: | IgG2b Kappa |
| Gene id: | 374378 |
| Gene name: | GALNTL4 |
| Gene alias: | GALNT15|GALNT18|GalNAc-T15|MGC71806 |
| Gene description: | UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 4 |
| Genbank accession: | NM_198516 |
| Immunogen: | GALNTL4 (NP_940918, 511 a.a. ~ 606 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SQQIHVGILSPTVDDDDNRCLVDVNSRPRLTECSYAKAKRMKLHWQFSQGGPIQNRKSKRCLELQENSDLEFGFQLVLQKCSGQHWSITNVLRSL* |
| Protein accession: | NP_940918 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Detection limit for recombinant GST tagged GALNTL4 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |