Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NDUFS7 monoclonal antibody (M01), clone 3A3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about NDUFS7 monoclonal antibody (M01), clone 3A3
| Brand: | Abnova |
| Reference: | H00374291-M01 |
| Product name: | NDUFS7 monoclonal antibody (M01), clone 3A3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NDUFS7. |
| Clone: | 3A3 |
| Isotype: | IgG2b Kappa |
| Gene id: | 374291 |
| Gene name: | NDUFS7 |
| Gene alias: | CI-20KD|FLJ45860|FLJ46880|MGC120002|MY017|PSST |
| Gene description: | NADH dehydrogenase (ubiquinone) Fe-S protein 7, 20kDa (NADH-coenzyme Q reductase) |
| Genbank accession: | NM_024407 |
| Immunogen: | NDUFS7 (NP_077718, 114 a.a. ~ 213 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGILQLQRKIKRERRLQIWYRR |
| Protein accession: | NP_077718 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Mitochondrial complex I activity and oxidative damage to mitochondrial proteins in the prefrontal cortex of patients with bipolar disorder.Andreazza AC, Shao L, Wang JF, Young LT. Arch Gen Psychiatry. 2010 Apr;67(4):360-8. |