| Brand: | Abnova |
| Reference: | H00373863-M16 |
| Product name: | DND1 monoclonal antibody (M16), clone 2G9 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant DND1. |
| Clone: | 2G9 |
| Isotype: | IgG2b Kappa |
| Gene id: | 373863 |
| Gene name: | DND1 |
| Gene alias: | MGC34750|RBMS4 |
| Gene description: | dead end homolog 1 (zebrafish) |
| Genbank accession: | NM_194249 |
| Immunogen: | DND1 (NP_919225, 61 a.a. ~ 152 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | FIGRLPQDVYEHQLIPLFQRVGRLYEFRLMMTFSGLNRGFAYARYSSRRGAQAAIATLHNHPLRPSCPLLVCRSTEKCELSVDGLPPNLTRS |
| Protein accession: | NP_919225 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |