GSTK1 MaxPab rabbit polyclonal antibody (D01) View larger

GSTK1 MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GSTK1 MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti,IF,WB-Tr,IP

More info about GSTK1 MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00373156-D01
Product name: GSTK1 MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human GSTK1 protein.
Gene id: 373156
Gene name: GSTK1
Gene alias: GST|GST13|GST13-13|GSTK1-1
Gene description: glutathione S-transferase kappa 1
Genbank accession: NM_015917.1
Immunogen: GSTK1 (NP_057001.1, 1 a.a. ~ 226 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL
Protein accession: NP_057001.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00373156-D01-2-A1-1.jpg
Application image note: GSTK1 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTK1 expression in human liver.
Applications: WB-Ti,IF,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy GSTK1 MaxPab rabbit polyclonal antibody (D01) now

Add to cart