| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,IF,WB-Tr |
| Brand: | Abnova |
| Reference: | H00373156-B01 |
| Product name: | GSTK1 MaxPab mouse polyclonal antibody (B01) |
| Product description: | Mouse polyclonal antibody raised against a full-length human GSTK1 protein. |
| Gene id: | 373156 |
| Gene name: | GSTK1 |
| Gene alias: | GST|GST13|GST13-13|GSTK1-1 |
| Gene description: | glutathione S-transferase kappa 1 |
| Genbank accession: | BC001231 |
| Immunogen: | GSTK1 (AAH01231, 1 a.a. ~ 226 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL |
| Protein accession: | AAH01231 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of GSTK1 expression in transfected 293T cell line (H00373156-T01) by GSTK1 MaxPab polyclonal antibody. Lane 1: GSTK1 transfected lysate(24.97 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,IF,WB-Tr |
| Shipping condition: | Dry Ice |