| Brand: | Abnova |
| Reference: | H00353497-A01 |
| Product name: | POLN polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant POLN. |
| Gene id: | 353497 |
| Gene name: | POLN |
| Gene alias: | POL4P |
| Gene description: | polymerase (DNA directed) nu |
| Genbank accession: | NM_181808 |
| Immunogen: | POLN (NP_861524, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MENYEALVGFDLCNTPLSSVAQKIMSAMHSGDLVDSKTWGKSTETMEVINKSSVKYSVQLEDRKTQSPEKKDLKSLRSQTSRGSAKLSPQSFSVRLTDQL |
| Protein accession: | NP_861524 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | DNA polymerase POLN participates in crosslink repair and homologous recombination.Moldovan GL, Madhavan MV, Mirchandani KD, McCaffrey RM, Vinciguerra P, D'Andrea AD. Mol Cell Biol. 2009 Dec 7. [Epub ahead of print] |