No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00348995-M03 |
Product name: | NUP43 monoclonal antibody (M03), clone 2G5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NUP43. |
Clone: | 2G5 |
Isotype: | IgG2a Kappa |
Gene id: | 348995 |
Gene name: | NUP43 |
Gene alias: | FLJ13287|bA350J20.1|p42 |
Gene description: | nucleoporin 43kDa |
Genbank accession: | NM_024647 |
Immunogen: | NUP43 (NP_078923.3, 281 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SEDGSLWHWDASTDVPEKSSLFHQGGRSSTFLSHSISNQANVHQSVISSWLSTDPAKDRIEITSLLPSRSLSVNTLDVLGPCLVCGTDAEAIYVTRHLFS |
Protein accession: | NP_078923.3 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of NUP43 expression in transfected 293T cell line by NUP43 monoclonal antibody (M03), clone 2G5. Lane 1: NUP43 transfected lysate(42.2 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |