Cart 52 Product Products 15 794,88 € (empty)
No products
265,00 € DAP Shipping
16 059,88 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 52 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 15 794,88 €
Total shipping (tax excl.) 265,00 €
Total (tax excl.) 16 059,88 €
Data sheet of NUP43 monoclonal antibody (M03), clone 2G5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about NUP43 monoclonal antibody (M03), clone 2G5
| Brand: | Abnova |
| Reference: | H00348995-M03 |
| Product name: | NUP43 monoclonal antibody (M03), clone 2G5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NUP43. |
| Clone: | 2G5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 348995 |
| Gene name: | NUP43 |
| Gene alias: | FLJ13287|bA350J20.1|p42 |
| Gene description: | nucleoporin 43kDa |
| Genbank accession: | NM_024647 |
| Immunogen: | NUP43 (NP_078923.3, 281 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SEDGSLWHWDASTDVPEKSSLFHQGGRSSTFLSHSISNQANVHQSVISSWLSTDPAKDRIEITSLLPSRSLSVNTLDVLGPCLVCGTDAEAIYVTRHLFS |
| Protein accession: | NP_078923.3 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of NUP43 expression in transfected 293T cell line by NUP43 monoclonal antibody (M03), clone 2G5. Lane 1: NUP43 transfected lysate(42.2 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |