No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00346606-M05 |
| Product name: | MOGAT3 monoclonal antibody (M05), clone 3F7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MOGAT3. |
| Clone: | 3F7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 346606 |
| Gene name: | MOGAT3 |
| Gene alias: | DC7|DGAT2L7|MGAT3|MGC119203|MGC119204 |
| Gene description: | monoacylglycerol O-acyltransferase 3 |
| Genbank accession: | NM_178176 |
| Immunogen: | MOGAT3 (NP_835470, 59 a.a. ~ 107 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | YLVWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDR |
| Protein accession: | NP_835470 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (31.13 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | http://www.abnova.com/application_image/ |
| Application image note: | Detection limit for recombinant GST tagged MOGAT3 is approximately 10ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |