MOGAT3 purified MaxPab mouse polyclonal antibody (B01P) View larger

MOGAT3 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MOGAT3 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about MOGAT3 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00346606-B01P
Product name: MOGAT3 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human MOGAT3 protein.
Gene id: 346606
Gene name: MOGAT3
Gene alias: DC7|DGAT2L7|MGAT3|MGC119203|MGC119204
Gene description: monoacylglycerol O-acyltransferase 3
Genbank accession: NM_178176.2
Immunogen: MOGAT3 (NP_835470.1, 1 a.a. ~ 341 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGVATTLQPPTTSKTLQKQHLEAVGAYQYVLTFLFMGPFFSLLVFVLLFTSLWPFSVFYLVWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDRNYVLGAHPHGIMCTGFLCNFSTESNGFSQLFPGLRPWLAVLAGLFYLPVYRDYIMSFGLCPVSRQSLDFILSQPQLGQAVVIMVGGAHEALYSVPGEHCLTLQKRKGFVRLALRHGASLVPVYSFGENDIFRLKAFATGSWQHWCQLTFKKLMGFSPCIFWGRGLFSATSWGLLPFAVPITTVVGRPIPVPQRLHPTEEEVNHYHALYMTALEQLFEEHKESCGVPASTCLTFI
Protein accession: NP_835470.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00346606-B01P-13-15-1.jpg
Application image note: Western Blot analysis of MOGAT3 expression in transfected 293T cell line (H00346606-T01) by MOGAT3 MaxPab polyclonal antibody.

Lane1:MOGAT3 transfected lysate(37.51 KDa).
Lane2:Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MOGAT3 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart